PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G2545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 1080aa    MW: 122644 Da    PI: 8.2577
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G2545genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.21.2e-10434479146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WT+eEd+ l+  v+++G ++W  Ia  +g +Rt+ qc  r+q 
      Gh_D12G2545 434 RNPWTAEEDKNLLLIVQEMGIDNWFDIAVSLGSNRTPFQCLARYQR 479
                      79******************************************96 PP

2Myb_DNA-binding42.21.9e-13488531246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT+eEd++l  av+ +G  +W ++a+t+  gRt+ qc +rw k
      Gh_D12G2545 488 REWTEEEDDQLRIAVEVFGESDWQSVASTLK-GRTGTQCSNRWKK 531
                      68****************************9.***********98 PP

3Myb_DNA-binding50.74.1e-16541584246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      grWT +Ed++l+ av ++G+++W++Ia+ ++ gRt  qc++rw +
      Gh_D12G2545 541 GRWTRDEDKRLKVAVLLFGPKNWRKIAEVVP-GRTQVQCRERWVN 584
                      8******************************.***********87 PP

4Myb_DNA-binding41.14.2e-13594636347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       WT+eEd +l  a++++G   W+++a ++   Rt++qc  rw ++
      Gh_D12G2545 594 IWTEEEDSRLEAAIEEHGYC-WSKVATCVA-SRTDNQCWRRWKTL 636
                      5*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.017329428IPR017877Myb-like domain
SMARTSM007175.1E-4333430IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-12336352IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-12401441IPR009057Homeodomain-like
SuperFamilySSF466894.87E-17410478IPR009057Homeodomain-like
PROSITE profilePS5009010.011429481IPR017877Myb-like domain
SMARTSM007173.5E-11433483IPR001005SANT/Myb domain
PfamPF002491.1E-9434479IPR001005SANT/Myb domain
CDDcd001673.48E-7436481No hitNo description
Gene3DG3DSA:1.10.10.607.4E-15442490IPR009057Homeodomain-like
SuperFamilySSF466891.45E-19466536IPR009057Homeodomain-like
PROSITE profilePS5129416.84482533IPR017930Myb domain
SMARTSM007171.2E-11486535IPR001005SANT/Myb domain
PfamPF002492.1E-11488531IPR001005SANT/Myb domain
CDDcd001679.58E-10489533No hitNo description
Gene3DG3DSA:1.10.10.604.4E-16491536IPR009057Homeodomain-like
PROSITE profilePS5129421.975534590IPR017930Myb domain
SuperFamilySSF466899.33E-25538633IPR009057Homeodomain-like
SMARTSM007179.4E-15539588IPR001005SANT/Myb domain
PfamPF002498.5E-15541584IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-18541589IPR009057Homeodomain-like
CDDcd001675.16E-12542586No hitNo description
Gene3DG3DSA:1.10.10.601.0E-15590636IPR009057Homeodomain-like
SMARTSM007173.3E-12591639IPR001005SANT/Myb domain
PROSITE profilePS5129415.255593641IPR017930Myb domain
PfamPF002495.7E-11595636IPR001005SANT/Myb domain
CDDcd001673.07E-10595636No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1080 aa     Download sequence    Send to blast
MSLKDEYDTV NDEEEEVDDV ELSGNENGVG FDEDMEALKK ACLRTGTDLN GLDIVSVDNE  60
RPSTLTAASP ASADSGSEDD LEIFRSIRNR LALSEDVYEP LSLKPLCTLP PISSDEDAED  120
DFETLRIIQK RFLAYSTDCT WKNSREDNME KTDPIYMTRT PLKDATGNDI CEKFQDYVQN  180
GNISHVSSDN AEMQPLSLVQ CDQSDVNVLS TYKSSRFPKS AQLLFDAIKK NRSYQMFLRS  240
KLAHIEVKIE ENKKLKERVK ILRDFQVSCK KLTGRALSAK KDPRIQLISA RKLRTFEDPE  300
INDKRVTADY GPLENSSVAS YRMALIDFPL KLERKNWSRE ERENLEKGIR QQFQERALQV  360
SVGWLSTSDG SPQDGNNLDG IIATVKDLEI TPERIREFLP KVDWNQLASF YVKGRCGAEC  420
ETRWLNHEDP LINRNPWTAE EDKNLLLIVQ EMGIDNWFDI AVSLGSNRTP FQCLARYQRS  480
LNPCILKREW TEEEDDQLRI AVEVFGESDW QSVASTLKGR TGTQCSNRWK KSLHPTRQRV  540
GRWTRDEDKR LKVAVLLFGP KNWRKIAEVV PGRTQVQCRE RWVNSLDPAL NVGIWTEEED  600
SRLEAAIEEH GYCWSKVATC VASRTDNQCW RRWKTLHPEE VPLLQEARKI RKAALISNFV  660
DRESERPALG PNDFNIQLPM ITATSEPSKE KGKRRRRRPE SEKENAAALR LSPEKRSHKS  720
CRKGAQTTTG RNPPLENNNC TEPAEDVTFQ KKRKREPPSG NNNHTKPAQH VSIQKKRKQP  780
PSGHVNCSDR KQDGAVQTYK IKQQSGSSKF VKSVQDNCSS HLLSALCMTG NHEAESFGSS  840
LTVKRRKNHK ASPKQFSKRS MCTESHEEQY SICSEISVFS GGDDGAEVMQ NSGVESEILG  900
ADDTSRKAKP RSKRKTCMNS LTSQGSRTIV AEHFKNLSAA KNTKKNRTKQ QQSKSRKSNK  960
PSGDENGQTE GDHQTLACFL RNKLKKGGCE IVDNACLSEG MDERSKIDQT HFSLQHCDGE  1020
NGTNIEIVDV VKKTVTPRDI VRELTKINKE DITLACLRKR LKKKRCVTIA QSSNHGDMSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-284036274155MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-284036274155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1692697KRRRRR
2943949KKNRTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5266202e-43HQ526620.1 Gossypium herbaceum clone NBRI_A_EYI1BW401A8HI1 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440312.10.0PREDICTED: uncharacterized protein LOC105765654 isoform X2
TrEMBLA0A0D2RPF50.0A0A0D2RPF5_G
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1